ALPK2 monoclonal antibody (M05), clone 4E5
  • ALPK2 monoclonal antibody (M05), clone 4E5

ALPK2 monoclonal antibody (M05), clone 4E5

Ref: AB-H00115701-M05
ALPK2 monoclonal antibody (M05), clone 4E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALPK2.
Información adicional
Size 100 ug
Gene Name ALPK2
Gene Alias FLJ34875|FLJ43253|HAK
Gene Description alpha-kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALPK2 (NP_443179, 201 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115701
Clone Number 4E5
Iso type IgG2a Kappa

Enviar un mensaje


ALPK2 monoclonal antibody (M05), clone 4E5

ALPK2 monoclonal antibody (M05), clone 4E5