TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)
  • TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)

TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00115650-D01P
TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNFRSF13C protein.
Información adicional
Size 100 ug
Gene Name TNFRSF13C
Gene Alias BAFF-R|BAFFR|CD268|MGC138235
Gene Description tumor necrosis factor receptor superfamily, member 13C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF13C (NP_443177.1, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115650

Enviar un mensaje


TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)

TNFRSF13C purified MaxPab rabbit polyclonal antibody (D01P)