VASN MaxPab rabbit polyclonal antibody (D01)
  • VASN MaxPab rabbit polyclonal antibody (D01)

VASN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00114990-D01
VASN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VASN protein.
Información adicional
Size 100 uL
Gene Name VASN
Gene Alias SLITL2
Gene Description vasorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VASN (AAH68575.1, 1 a.a. ~ 673 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 114990

Enviar un mensaje


VASN MaxPab rabbit polyclonal antibody (D01)

VASN MaxPab rabbit polyclonal antibody (D01)