C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)

C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00114898-D01P
C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C1QTNF2 protein.
Información adicional
Size 100 ug
Gene Name C1QTNF2
Gene Alias CTRP2|zacrp2
Gene Description C1q and tumor necrosis factor related protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QTNF2 (AAH11699.1, 1 a.a. ~ 285 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114898

Enviar un mensaje


C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)

C1QTNF2 purified MaxPab rabbit polyclonal antibody (D01P)