OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)
  • OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)

OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00114882-B01P
OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OSBPL8 protein.
Información adicional
Size 50 ug
Gene Name OSBPL8
Gene Alias DKFZp686A11164|MGC126578|MGC133203|MST120|MSTP120|ORP8|OSBP10
Gene Description oxysterol binding protein-like 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSTSSKLTKKESLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSBPL8 (NP_001003712.1, 1 a.a. ~ 847 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114882

Enviar un mensaje


OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)

OSBPL8 purified MaxPab mouse polyclonal antibody (B01P)