TRIM9 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM9 purified MaxPab mouse polyclonal antibody (B01P)

TRIM9 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00114088-B01P
TRIM9 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM9 protein.
Información adicional
Size 50 ug
Gene Name TRIM9
Gene Alias KIAA0282|RNF91|SPRING
Gene Description tripartite motif-containing 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM9 (NP_443210.1, 1 a.a. ~ 550 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114088

Enviar un mensaje


TRIM9 purified MaxPab mouse polyclonal antibody (B01P)

TRIM9 purified MaxPab mouse polyclonal antibody (B01P)