TOE1 purified MaxPab rabbit polyclonal antibody (D01P)
  • TOE1 purified MaxPab rabbit polyclonal antibody (D01P)

TOE1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00114034-D01P
TOE1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TOE1 protein.
Información adicional
Size 100 ug
Gene Name TOE1
Gene Alias FLJ13949
Gene Description target of EGR1, member 1 (nuclear)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCEREN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOE1 (NP_079353.2, 1 a.a. ~ 510 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114034

Enviar un mensaje


TOE1 purified MaxPab rabbit polyclonal antibody (D01P)

TOE1 purified MaxPab rabbit polyclonal antibody (D01P)