CAPZA3 MaxPab rabbit polyclonal antibody (D01)
  • CAPZA3 MaxPab rabbit polyclonal antibody (D01)

CAPZA3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00093661-D01
CAPZA3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAPZA3 protein.
Información adicional
Size 100 uL
Gene Name CAPZA3
Gene Alias CAPPA3|Gsg3
Gene Description capping protein (actin filament) muscle Z-line, alpha 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYYLLQNQLKDIQSHGIIQNEAEYLRVVLLCALKLYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAPZA3 (AAH16745.1, 1 a.a. ~ 299 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 93661

Enviar un mensaje


CAPZA3 MaxPab rabbit polyclonal antibody (D01)

CAPZA3 MaxPab rabbit polyclonal antibody (D01)