TIMM50 polyclonal antibody (A01)
  • TIMM50 polyclonal antibody (A01)

TIMM50 polyclonal antibody (A01)

Ref: AB-H00092609-A01
TIMM50 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TIMM50.
Información adicional
Size 50 uL
Gene Name TIMM50
Gene Alias MGC102733|TIM50|TIM50L
Gene Description translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM50 (NP_001001563, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 92609

Enviar un mensaje


TIMM50 polyclonal antibody (A01)

TIMM50 polyclonal antibody (A01)