BTF3L4 monoclonal antibody (M05), clone 2G10
  • BTF3L4 monoclonal antibody (M05), clone 2G10

BTF3L4 monoclonal antibody (M05), clone 2G10

Ref: AB-H00091408-M05
BTF3L4 monoclonal antibody (M05), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant BTF3L4.
Información adicional
Size 100 ug
Gene Name BTF3L4
Gene Alias MGC23908|MGC88389|RP4-800M22.5
Gene Description basic transcription factor 3-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTF3L4 (NP_689478.1, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 91408
Clone Number 2G10
Iso type IgG2a Kappa

Enviar un mensaje


BTF3L4 monoclonal antibody (M05), clone 2G10

BTF3L4 monoclonal antibody (M05), clone 2G10