ZNF598 polyclonal antibody (A01)
  • ZNF598 polyclonal antibody (A01)

ZNF598 polyclonal antibody (A01)

Ref: AB-H00090850-A01
ZNF598 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF598.
Información adicional
Size 50 uL
Gene Name ZNF598
Gene Alias DKFZp762F135|FLJ00086
Gene Description zinc finger protein 598
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIPIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCPELP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF598 (NP_835461, 28 a.a. ~ 126 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 90850

Enviar un mensaje


ZNF598 polyclonal antibody (A01)

ZNF598 polyclonal antibody (A01)