ZNF622 monoclonal antibody (M01), clone 4G6
  • ZNF622 monoclonal antibody (M01), clone 4G6

ZNF622 monoclonal antibody (M01), clone 4G6

Ref: AB-H00090441-M01
ZNF622 monoclonal antibody (M01), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZNF622.
Información adicional
Size 100 ug
Gene Name ZNF622
Gene Alias MGC17552|MGC2485|ZPR9
Gene Description zinc finger protein 622
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF622 (NP_219482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 90441
Clone Number 4G6
Iso type IgG1 Kappa

Enviar un mensaje


ZNF622 monoclonal antibody (M01), clone 4G6

ZNF622 monoclonal antibody (M01), clone 4G6