ZSWIM1 MaxPab mouse polyclonal antibody (B01P)
  • ZSWIM1 MaxPab mouse polyclonal antibody (B01P)

ZSWIM1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00090204-B01P
ZSWIM1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZSWIM1 protein.
Información adicional
Size 50 ug
Gene Name ZSWIM1
Gene Alias C20orf162
Gene Description zinc finger, SWIM-type containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLERLKAPWSAALQRKYFDLGIWTAPISPMALTMLNGLLIKDSSPPMLLHQVNKTAQLDTFNYQSCFMQSVFDHFPEILFIHRTYNPRGKVLYTFLVDGPRVQLEGHLARAVYFAIPAKEDTEGLAQMFQVFKKFNPAWERVCTILVDPHFLPLPILAMEFPTAEVLLSAFHICKFLQAKFYQLSLERPVERLLLTSLQSTMCSATAGNLRKLYTLLSNCIPPAKLPELHSHWLLNDRIWLAHRWRSRAESSHYF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZSWIM1 (NP_542170, 1 a.a. ~ 485 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 90204

Enviar un mensaje


ZSWIM1 MaxPab mouse polyclonal antibody (B01P)

ZSWIM1 MaxPab mouse polyclonal antibody (B01P)