TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)
  • TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)

TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00089882-B01P
TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPD52L3 protein.
Información adicional
Size 50 ug
Gene Name TPD52L3
Gene Alias MGC26757|MGC45374|NYD-SP25|hD55
Gene Description tumor protein D52-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGLMGTIKSKVSGGKRAWP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPD52L3 (NP_277051.3, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 89882

Enviar un mensaje


TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)

TPD52L3 purified MaxPab mouse polyclonal antibody (B01P)