ALG2 purified MaxPab mouse polyclonal antibody (B01P)
  • ALG2 purified MaxPab mouse polyclonal antibody (B01P)

ALG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00085365-B01P
ALG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ALG2 protein.
Información adicional
Size 50 ug
Gene Name ALG2
Gene Alias CDGIi|FLJ14511|hALPG2
Gene Description asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ALG2 (NP_149078.1, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 85365

Enviar un mensaje


ALG2 purified MaxPab mouse polyclonal antibody (B01P)

ALG2 purified MaxPab mouse polyclonal antibody (B01P)