TRIM5 monoclonal antibody (M06), clone 2A6
  • TRIM5 monoclonal antibody (M06), clone 2A6

TRIM5 monoclonal antibody (M06), clone 2A6

Ref: AB-H00085363-M06
TRIM5 monoclonal antibody (M06), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM5.
Información adicional
Size 100 ug
Gene Name TRIM5
Gene Alias RNF88|TRIM5alpha
Gene Description tripartite motif-containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM5 (NP_149023, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 85363
Clone Number 2A6
Iso type IgG2a Kappa

Enviar un mensaje


TRIM5 monoclonal antibody (M06), clone 2A6

TRIM5 monoclonal antibody (M06), clone 2A6