USP45 polyclonal antibody (A01)
  • USP45 polyclonal antibody (A01)

USP45 polyclonal antibody (A01)

Ref: AB-H00085015-A01
USP45 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP45.
Información adicional
Size 50 uL
Gene Name USP45
Gene Alias MGC14793
Gene Description ubiquitin specific peptidase 45
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP45 (XP_371838, 106 a.a. ~ 196 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 85015

Enviar un mensaje


USP45 polyclonal antibody (A01)

USP45 polyclonal antibody (A01)