TNFRSF19L polyclonal antibody (A01)
  • TNFRSF19L polyclonal antibody (A01)

TNFRSF19L polyclonal antibody (A01)

Ref: AB-H00084957-A01
TNFRSF19L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFRSF19L.
Información adicional
Size 50 uL
Gene Name RELT
Gene Alias FLJ14993|TNFRSF19L
Gene Description RELT tumor necrosis factor receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFRSF19L (NP_116260, 26 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84957

Enviar un mensaje


TNFRSF19L polyclonal antibody (A01)

TNFRSF19L polyclonal antibody (A01)