ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)

ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00084936-D01P
ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZFYVE19 protein.
Información adicional
Size 100 ug
Gene Name ZFYVE19
Gene Alias FLJ14840|MPFYVE
Gene Description zinc finger, FYVE domain containing 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESRCYGCAVKFTLFKKEYGCKNCGRAFRSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZFYVE19 (AAH21092.1, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84936

Enviar un mensaje


ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)

ZFYVE19 purified MaxPab rabbit polyclonal antibody (D01P)