AMID polyclonal antibody (A01)
  • AMID polyclonal antibody (A01)

AMID polyclonal antibody (A01)

Ref: AB-H00084883-A01
AMID polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AMID.
Información adicional
Size 50 uL
Gene Name AIFM2
Gene Alias AMID|PRG3|RP11-367H5.2
Gene Description apoptosis-inducing factor, mitochondrion-associated, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AMID (NP_116186, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84883

Enviar un mensaje


AMID polyclonal antibody (A01)

AMID polyclonal antibody (A01)