TRIM52 polyclonal antibody (A01)
  • TRIM52 polyclonal antibody (A01)

TRIM52 polyclonal antibody (A01)

Ref: AB-H00084851-A01
TRIM52 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM52.
Información adicional
Size 50 uL
Gene Name TRIM52
Gene Alias MGC16175|RNF102
Gene Description tripartite motif-containing 52
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM52 (NP_116154, 201 a.a. ~ 297 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84851

Enviar un mensaje


TRIM52 polyclonal antibody (A01)

TRIM52 polyclonal antibody (A01)