CAPS2 monoclonal antibody (M02), clone 3C6
  • CAPS2 monoclonal antibody (M02), clone 3C6

CAPS2 monoclonal antibody (M02), clone 3C6

Ref: AB-H00084698-M02
CAPS2 monoclonal antibody (M02), clone 3C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAPS2.
Información adicional
Size 100 ug
Gene Name CAPS2
Gene Alias FLJ34520|UG0636c06
Gene Description calcyphosine 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq YRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISGHSTEEEIKSSFLETLKVACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVNILRTPWGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAPS2 (NP_115995.1, 285 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84698
Clone Number 3C6
Iso type IgG2b Kappa

Enviar un mensaje


CAPS2 monoclonal antibody (M02), clone 3C6

CAPS2 monoclonal antibody (M02), clone 3C6