TRIM63 monoclonal antibody (M01A), clone 6G6
  • TRIM63 monoclonal antibody (M01A), clone 6G6

TRIM63 monoclonal antibody (M01A), clone 6G6

Ref: AB-H00084676-M01A
TRIM63 monoclonal antibody (M01A), clone 6G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM63.
Información adicional
Size 200 uL
Gene Name TRIM63
Gene Alias FLJ32380|IRF|MURF1|MURF2|RNF28|SMRZ
Gene Description tripartite motif-containing 63
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM63 (NP_115977, 254 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 84676
Clone Number 6G6
Iso type IgG1 Kappa

Enviar un mensaje


TRIM63 monoclonal antibody (M01A), clone 6G6

TRIM63 monoclonal antibody (M01A), clone 6G6