ARPM1 monoclonal antibody (M01), clone 2H8
  • ARPM1 monoclonal antibody (M01), clone 2H8

ARPM1 monoclonal antibody (M01), clone 2H8

Ref: AB-H00084517-M01
ARPM1 monoclonal antibody (M01), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARPM1.
Información adicional
Size 100 ug
Gene Name ARPM1
Gene Alias MGC15664
Gene Description actin related protein M1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARPM1 (NP_115876.2, 24 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84517
Clone Number 2H8
Iso type IgG2a Kappa

Enviar un mensaje


ARPM1 monoclonal antibody (M01), clone 2H8

ARPM1 monoclonal antibody (M01), clone 2H8