BTBD12 purified MaxPab mouse polyclonal antibody (B01P)
  • BTBD12 purified MaxPab mouse polyclonal antibody (B01P)

BTBD12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084464-B01P
BTBD12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTBD12 protein.
Información adicional
Size 50 ug
Gene Name BTBD12
Gene Alias KIAA1784|KIAA1987
Gene Description BTB (POZ) domain containing 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHEEDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTBD12 (AAH36335.1, 1 a.a. ~ 1151 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84464

Enviar un mensaje


BTBD12 purified MaxPab mouse polyclonal antibody (B01P)

BTBD12 purified MaxPab mouse polyclonal antibody (B01P)