C17orf37 purified MaxPab mouse polyclonal antibody (B01P)
  • C17orf37 purified MaxPab mouse polyclonal antibody (B01P)

C17orf37 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084299-B01P
C17orf37 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
Información adicional
Size 50 ug
Gene Name C17orf37
Gene Alias C35|MGC14832|ORB3|RDX12|XTP4
Gene Description chromosome 17 open reading frame 37
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84299

Enviar un mensaje


C17orf37 purified MaxPab mouse polyclonal antibody (B01P)

C17orf37 purified MaxPab mouse polyclonal antibody (B01P)