C1orf57 monoclonal antibody (M04), clone 2C3
  • C1orf57 monoclonal antibody (M04), clone 2C3

C1orf57 monoclonal antibody (M04), clone 2C3

Ref: AB-H00084284-M04
C1orf57 monoclonal antibody (M04), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C1orf57.
Información adicional
Size 100 ug
Gene Name C1orf57
Gene Alias FLJ11383|MGC13186|RP4-678E16.2
Gene Description chromosome 1 open reading frame 57
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf57 (NP_115700, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84284
Clone Number 2C3
Iso type IgG2a Kappa

Enviar un mensaje


C1orf57 monoclonal antibody (M04), clone 2C3

C1orf57 monoclonal antibody (M04), clone 2C3