C1orf57 purified MaxPab mouse polyclonal antibody (B01P)
  • C1orf57 purified MaxPab mouse polyclonal antibody (B01P)

C1orf57 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084284-B01P
C1orf57 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1orf57 protein.
Información adicional
Size 50 ug
Gene Name C1orf57
Gene Alias FLJ11383|MGC13186|RP4-678E16.2
Gene Description chromosome 1 open reading frame 57
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1orf57 (NP_115700.1, 1 a.a. ~ 190 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84284

Enviar un mensaje


C1orf57 purified MaxPab mouse polyclonal antibody (B01P)

C1orf57 purified MaxPab mouse polyclonal antibody (B01P)