C1orf57 polyclonal antibody (A01)
  • C1orf57 polyclonal antibody (A01)

C1orf57 polyclonal antibody (A01)

Ref: AB-H00084284-A01
C1orf57 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C1orf57.
Información adicional
Size 50 uL
Gene Name C1orf57
Gene Alias FLJ11383|MGC13186|RP4-678E16.2
Gene Description chromosome 1 open reading frame 57
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1orf57 (NP_115700, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 84284

Enviar un mensaje


C1orf57 polyclonal antibody (A01)

C1orf57 polyclonal antibody (A01)