C9orf89 purified MaxPab mouse polyclonal antibody (B01P)
  • C9orf89 purified MaxPab mouse polyclonal antibody (B01P)

C9orf89 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00084270-B01P
C9orf89 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C9orf89 protein.
Información adicional
Size 50 ug
Gene Name C9orf89
Gene Alias BinCARD|MGC110898|MGC11115|bA370F5.1
Gene Description chromosome 9 open reading frame 89
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C9orf89 (NP_115686.3, 1 a.a. ~ 183 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84270

Enviar un mensaje


C9orf89 purified MaxPab mouse polyclonal antibody (B01P)

C9orf89 purified MaxPab mouse polyclonal antibody (B01P)