TSSK6 MaxPab rabbit polyclonal antibody (D01)
  • TSSK6 MaxPab rabbit polyclonal antibody (D01)

TSSK6 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00083983-D01
TSSK6 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSSK6 protein.
Información adicional
Size 100 uL
Gene Name TSSK6
Gene Alias FLJ24002|SSTK|TSSK4
Gene Description testis-specific serine kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSSK6 (NP_114426.1, 1 a.a. ~ 273 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 83983

Enviar un mensaje


TSSK6 MaxPab rabbit polyclonal antibody (D01)

TSSK6 MaxPab rabbit polyclonal antibody (D01)