TMTC1 purified MaxPab mouse polyclonal antibody (B01P)
  • TMTC1 purified MaxPab mouse polyclonal antibody (B01P)

TMTC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00083857-B01P
TMTC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMTC1 protein.
Información adicional
Size 50 ug
Gene Name TMTC1
Gene Alias ARG99|FLJ31400|FLJ41625|OLF
Gene Description transmembrane and tetratricopeptide repeat containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNPFYFHAVNIILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPIHTEAVAGIVGRADVLACLLFLLAFLSYNRSLDQGCVGGSFPSTVSPFFLLLSLFLGTCAMLVKETGITVFGVCLVYDLFSLSNKQDKSSNGALCPRSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGCHSPLPPEPKSSGFPVSPRAVWSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVETIWDMRNLATIFLAVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMTC1 (AAH42083, 1 a.a. ~ 774 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83857

Enviar un mensaje


TMTC1 purified MaxPab mouse polyclonal antibody (B01P)

TMTC1 purified MaxPab mouse polyclonal antibody (B01P)