ANGPTL6 monoclonal antibody (M01), clone 1A11
  • ANGPTL6 monoclonal antibody (M01), clone 1A11

ANGPTL6 monoclonal antibody (M01), clone 1A11

Ref: AB-H00083854-M01
ANGPTL6 monoclonal antibody (M01), clone 1A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ANGPTL6.
Información adicional
Size 100 ug
Gene Name ANGPTL6
Gene Alias AGF|ARP5
Gene Description angiopoietin-like 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANGPTL6 (NP_114123, 211 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83854
Clone Number 1A11
Iso type IgG2a Kappa

Enviar un mensaje


ANGPTL6 monoclonal antibody (M01), clone 1A11

ANGPTL6 monoclonal antibody (M01), clone 1A11