USP26 monoclonal antibody (M01), clone 4G8
  • USP26 monoclonal antibody (M01), clone 4G8

USP26 monoclonal antibody (M01), clone 4G8

Ref: AB-H00083844-M01
USP26 monoclonal antibody (M01), clone 4G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP26.
Información adicional
Size 100 ug
Gene Name USP26
Gene Alias MGC120066|MGC120067|MGC120068
Gene Description ubiquitin specific peptidase 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP26 (NP_112223, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83844
Clone Number 4G8
Iso type IgG2a Kappa

Enviar un mensaje


USP26 monoclonal antibody (M01), clone 4G8

USP26 monoclonal antibody (M01), clone 4G8