UNC93B1 polyclonal antibody (A01)
  • UNC93B1 polyclonal antibody (A01)

UNC93B1 polyclonal antibody (A01)

Ref: AB-H00081622-A01
UNC93B1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UNC93B1.
Información adicional
Size 50 uL
Gene Name UNC93B1
Gene Alias MGC126617|UNC93|UNC93B
Gene Description unc-93 homolog B1 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNC93B1 (NP_112192, 83 a.a. ~ 135 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 81622

Enviar un mensaje


UNC93B1 polyclonal antibody (A01)

UNC93B1 polyclonal antibody (A01)