TUBB1 MaxPab rabbit polyclonal antibody (D01)
  • TUBB1 MaxPab rabbit polyclonal antibody (D01)

TUBB1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00081027-D01
TUBB1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBB1 protein.
Información adicional
Size 100 uL
Gene Name TUBB1
Gene Alias dJ543J19.4
Gene Description tubulin, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBB1 (NP_110400.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 81027

Enviar un mensaje


TUBB1 MaxPab rabbit polyclonal antibody (D01)

TUBB1 MaxPab rabbit polyclonal antibody (D01)