TMPRSS5 monoclonal antibody (M09), clone 2E5
  • TMPRSS5 monoclonal antibody (M09), clone 2E5

TMPRSS5 monoclonal antibody (M09), clone 2E5

Ref: AB-H00080975-M09
TMPRSS5 monoclonal antibody (M09), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.
Información adicional
Size 100 ug
Gene Name TMPRSS5
Gene Alias MGC141886|MGC148044|SPINESIN
Gene Description transmembrane protease, serine 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TMPRSS5 (NP_110397.1, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80975
Clone Number 2E5
Iso type IgG1 Kappa

Enviar un mensaje


TMPRSS5 monoclonal antibody (M09), clone 2E5

TMPRSS5 monoclonal antibody (M09), clone 2E5