APOL3 monoclonal antibody (M02), clone 8F5
  • APOL3 monoclonal antibody (M02), clone 8F5

APOL3 monoclonal antibody (M02), clone 8F5

Ref: AB-H00080833-M02
APOL3 monoclonal antibody (M02), clone 8F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant APOL3.
Información adicional
Size 100 ug
Gene Name APOL3
Gene Alias APOLIII|CG12-1
Gene Description apolipoprotein L, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80833
Clone Number 8F5
Iso type IgG2a Kappa

Enviar un mensaje


APOL3 monoclonal antibody (M02), clone 8F5

APOL3 monoclonal antibody (M02), clone 8F5