NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)
  • NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)

NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080762-B01P
NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDFIP1 protein.
Información adicional
Size 50 ug
Gene Name NDFIP1
Gene Alias MGC10924|N4WBP5
Gene Description Nedd4 family interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDFIP1 (NP_085048.1, 1 a.a. ~ 221 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80762

Enviar un mensaje


NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)

NDFIP1 purified MaxPab mouse polyclonal antibody (B01P)