C6orf25 MaxPab mouse polyclonal antibody (B01P)
  • C6orf25 MaxPab mouse polyclonal antibody (B01P)

C6orf25 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080739-B01P
C6orf25 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C6orf25 protein.
Información adicional
Size 50 ug
Gene Name C6orf25
Gene Alias G6b|MGC142279|MGC142281|NG31
Gene Description chromosome 6 open reading frame 25
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFALSPPHSSTCENRAPEASKGGRAQDSRGPGPGTEPALCGSGPSSPQQAPPAVHSGPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C6orf25 (NP_079536.2, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80739

Enviar un mensaje


C6orf25 MaxPab mouse polyclonal antibody (B01P)

C6orf25 MaxPab mouse polyclonal antibody (B01P)