ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)

ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00080329-D01P
ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ULBP1 protein.
Información adicional
Size 100 ug
Gene Name ULBP1
Gene Alias RAET1I
Gene Description UL16 binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ULBP1 (NP_079494.1, 1 a.a. ~ 244 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80329

Enviar un mensaje


ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)

ULBP1 purified MaxPab rabbit polyclonal antibody (D01P)