C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)
  • C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)

C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00080183-D01P
C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C13orf18 protein.
Información adicional
Size 100 ug
Gene Name C13orf18
Gene Alias FLJ21562|FLJ43762
Gene Description chromosome 13 open reading frame 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVSNHYFLLCVNLPLREIHTPGPSPSCLGDSLAETTLSEDTTDSVGSASPHGSSEKSSSFSLSSTEVHMVRPGYSHRVSLPTSPRILATSPYPETDSAFFEPSHLTSAADEGAVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFVILELGDFNDITETCSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C13orf18 (AAH43488.1, 1 a.a. ~ 595 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80183

Enviar un mensaje


C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)

C13orf18 purified MaxPab rabbit polyclonal antibody (D01P)