ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00080150-D01P
ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASRGL1 protein.
Información adicional
Size 100 ug
Gene Name ASRGL1
Gene Alias ALP|ALP1|FLJ22316
Gene Description asparaginase like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASRGL1 (NP_001077395.1, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80150

Enviar un mensaje


ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)

ASRGL1 purified MaxPab rabbit polyclonal antibody (D01P)