TRIM46 monoclonal antibody (M05), clone 3G11
  • TRIM46 monoclonal antibody (M05), clone 3G11

TRIM46 monoclonal antibody (M05), clone 3G11

Ref: AB-H00080128-M05
TRIM46 monoclonal antibody (M05), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM46.
Información adicional
Size 100 ug
Gene Name TRIM46
Gene Alias FLJ23229|GENEY|TRIFIC
Gene Description tripartite motif-containing 46
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM46 (NP_079334, 451 a.a. ~ 560 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80128
Clone Number 3G11
Iso type IgG2a Kappa

Enviar un mensaje


TRIM46 monoclonal antibody (M05), clone 3G11

TRIM46 monoclonal antibody (M05), clone 3G11