TRIM46 polyclonal antibody (A01)
  • TRIM46 polyclonal antibody (A01)

TRIM46 polyclonal antibody (A01)

Ref: AB-H00080128-A01
TRIM46 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRIM46.
Información adicional
Size 50 uL
Gene Name TRIM46
Gene Alias FLJ23229|GENEY|TRIFIC
Gene Description tripartite motif-containing 46
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM46 (NP_079334, 451 a.a. ~ 560 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 80128

Enviar un mensaje


TRIM46 polyclonal antibody (A01)

TRIM46 polyclonal antibody (A01)