ZNF614 MaxPab mouse polyclonal antibody (B01P)
  • ZNF614 MaxPab mouse polyclonal antibody (B01P)

ZNF614 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00080110-B01P
ZNF614 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF614 protein.
Información adicional
Size 50 ug
Gene Name ZNF614
Gene Alias FLJ21941|MGC120638
Gene Description zinc finger protein 614
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGETGSLERPRQADHLRSEVQDQPGQRGETLCLLKIHTKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF614 (ENSP00000348674, 1 a.a. ~ 198 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 80110

Enviar un mensaje


ZNF614 MaxPab mouse polyclonal antibody (B01P)

ZNF614 MaxPab mouse polyclonal antibody (B01P)