UBTD1 MaxPab mouse polyclonal antibody (B01)
  • UBTD1 MaxPab mouse polyclonal antibody (B01)

UBTD1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00080019-B01
UBTD1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBTD1 protein.
Información adicional
Size 50 uL
Gene Name UBTD1
Gene Alias FLJ11807
Gene Description ubiquitin domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBTD1 (NP_079230, 1 a.a. ~ 227 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 80019

Enviar un mensaje


UBTD1 MaxPab mouse polyclonal antibody (B01)

UBTD1 MaxPab mouse polyclonal antibody (B01)