C20orf172 monoclonal antibody (M01), clone 2A7
  • C20orf172 monoclonal antibody (M01), clone 2A7

C20orf172 monoclonal antibody (M01), clone 2A7

Ref: AB-H00079980-M01
C20orf172 monoclonal antibody (M01), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C20orf172.
Información adicional
Size 100 ug
Gene Name DSN1
Gene Alias C20orf172|FLJ13346|MGC32987|MIS13|dJ469A13.2
Gene Description DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C20orf172 (NP_079194.2, 257 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79980
Clone Number 2A7
Iso type IgG2a Kappa

Enviar un mensaje


C20orf172 monoclonal antibody (M01), clone 2A7

C20orf172 monoclonal antibody (M01), clone 2A7