TUBAL3 MaxPab rabbit polyclonal antibody (D01)
  • TUBAL3 MaxPab rabbit polyclonal antibody (D01)

TUBAL3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00079861-D01
TUBAL3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBAL3 protein.
Información adicional
Size 100 uL
Gene Name TUBAL3
Gene Alias FLJ21665|MGC119347|MGC119349
Gene Description tubulin, alpha-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MDQLENAKMEHTNASFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVLERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNSVLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBAL3 (AAH98247.1, 1 a.a. ~ 406 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 79861

Enviar un mensaje


TUBAL3 MaxPab rabbit polyclonal antibody (D01)

TUBAL3 MaxPab rabbit polyclonal antibody (D01)