TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)
  • TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)

TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079626-B01P
TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFAIP8L2 protein.
Información adicional
Size 50 ug
Gene Name TNFAIP8L2
Gene Alias FLJ23467|TIPE2
Gene Description tumor necrosis factor, alpha-induced protein 8-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFAIP8L2 (AAH63014, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79626

Enviar un mensaje


TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)

TNFAIP8L2 purified MaxPab mouse polyclonal antibody (B01P)